Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFM Rabbit pAb (APR21807N)

Product Specifications

Background

This gene is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. The protein encoded by this gene is regulated developmentally, expressed in the liver and secreted into the bloodstream.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AFM Rabbit pAb (APR21807N) .

Synonyms

AFM; ALB2; ALBA; ALF; afamin

Gene ID

173

UniProt

P43652

Cellular Locus

Secreted

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 69kDa Observed MW: 69kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=173

Uniprot URL

https://www.uniprot.org/uniprot/P43652

AA Sequence

EDVSSNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4(S)-Edoxaban Pyridine N-Oxide
TRC-E555100-5MG 5 mg

4(S)-Edoxaban Pyridine N-Oxide

Sign In for Pricing
View Details
Lentiviral human ATF2 shRNA (UAS) - Lentiviral human ATF2 shRNA (UAS) (100)
GTR15116838 1 Vial

Lentiviral human ATF2 shRNA (UAS) - Lentiviral human ATF2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Electroscope, Pith Ball
1080380/3 1 Each

Electroscope, Pith Ball

Sign In for Pricing
View Details
ICOS Cynomolgus Recombinant Protein
TP727839 10 µg

ICOS Cynomolgus Recombinant Protein

Sign In for Pricing
View Details
Human STOmL3 (NM_001144033) AAV Particle
RC226823A1V 250 µL

Human STOmL3 (NM_001144033) AAV Particle

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Chaperone protein DnaK (dnaK), partial
MBS1182417 Inquire

Recombinant Xylella fastidiosa Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details