Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RXRα Rabbit pAb (APR21799N)

Product Specifications

Background

Retinoid X receptors (RXRs) and retinoic acid receptors (RARs) are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors function as transcription factors by binding as homodimers or heterodimers to specific sequences in the promoters of target genes. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RXRα Rabbit pAb (APR21796N2) .

Synonyms

NR2B1; RXRA

Gene ID

6256

UniProt

P19793

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa/50kDa Observed MW: 51KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6256

Uniprot URL

https://www.uniprot.org/uniprot/P19793

AA Sequence

MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)
MBS1294298-01 0.02 mg (E-Coli)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)
MBS1294298-02 0.1 mg (E-Coli)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)
MBS1294298-03 0.02 mg (Yeast)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)
MBS1294298-04 0.1 mg (Yeast)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)
MBS1294298-05 0.02 mg (Baculovirus)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)
MBS1294298-06 0.02 mg (Mammalian-Cell)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R346 (MIMI_R346)

Sign In for Pricing
View Details