Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPF1/RENT1 Rabbit pAb (APR21767N)

Product Specifications

Background

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD) . When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UPF1/RENT1 Rabbit pAb (APR21767N) .

Synonyms

UPF1; HUPF1; NORF1; RENT1; pNORF1; smg-2

Gene ID

5976

UniProt

Q92900

Cellular Locus

Cytoplasm, Nucleus, P-body

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 123kDa/124kDa Observed MW: 130kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5976

Uniprot URL

https://www.uniprot.org/uniprot/Q92900

AA Sequence

KENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDMRLMQGDEICLRYKGDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-UIF Antibody, Affinity Purified
A303-525A-T 10 µg

Rabbit anti-UIF Antibody, Affinity Purified

Sign In for Pricing
View Details
Mmu-miR-3088-5p antagomir
HY-RI02966A-01 5 nmol

Mmu-miR-3088-5p antagomir

Sign In for Pricing
View Details
Mmu-miR-3088-5p antagomir
HY-RI02966A-02 20 nmol

Mmu-miR-3088-5p antagomir

Sign In for Pricing
View Details
Recombinant Human Vasoactive Intestinal Peptide/VIP (C-6His)
32-7914-10 10 µg

Recombinant Human Vasoactive Intestinal Peptide/VIP (C-6His)

Sign In for Pricing
View Details
CD200 (OX2) (APC) discontinued
C2548-96L1-APC 100 µL

CD200 (OX2) (APC) discontinued

Sign In for Pricing
View Details
Genorise® Sheep GLUT1 Polyclonal Antibody
GR130034 100 µg

Genorise® Sheep GLUT1 Polyclonal Antibody

Sign In for Pricing
View Details