Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG2 Rabbit pAb (APR21760N)

Product Specifications

Background

This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man (2) GlcNAc (2) -dolichol diphosphate and Man (1) GlcNAc (2) -dolichol diphosphate to form Man (3) GlcNAc (2) -dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii) . Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ALG2 Rabbit pAb (APR21760N) .

Synonyms

ALG2; CDG1I; CDGIi; CMS14; CMSTA3; NET38; hALPG2; alpha-1; 3/1

Gene ID

85365

UniProt

Q9H553

Cellular Locus

Membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa/47kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=85365

Uniprot URL

https://www.uniprot.org/uniprot/Q9H553

AA Sequence

DVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBPF7 sgRNA CRISPR Lentivector (Human) (Target 2)
K1395003 1.0 µg DNA

NBPF7 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
BCL-2 (Center Ser70) Rabbit pAb
MBS8555668-01 0.1 mL

BCL-2 (Center Ser70) Rabbit pAb

Sign In for Pricing
View Details
BCL-2 (Center Ser70) Rabbit pAb
MBS8555668-02 0.1 mL (AF405L)

BCL-2 (Center Ser70) Rabbit pAb

Sign In for Pricing
View Details
BCL-2 (Center Ser70) Rabbit pAb
MBS8555668-03 0.1 mL (AF405S)

BCL-2 (Center Ser70) Rabbit pAb

Sign In for Pricing
View Details
BCL-2 (Center Ser70) Rabbit pAb
MBS8555668-04 0.1 mL (AF610)

BCL-2 (Center Ser70) Rabbit pAb

Sign In for Pricing
View Details
BCL-2 (Center Ser70) Rabbit pAb
MBS8555668-05 0.1 mL (AF635)

BCL-2 (Center Ser70) Rabbit pAb

Sign In for Pricing
View Details