Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PICK1 Rabbit pAb (APR21745N)

Product Specifications

Background

The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA) . This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PICK1 Rabbit pAb (APR21745N) .

Synonyms

PICK1; PICK; PRKCABP

Gene ID

9463

UniProt

Q9NRD5

Cellular Locus

Cell junction, Cytoplasm, Lipid-anchor, Membrane, Peripheral membrane protein, cytoskeleton, perinuclear region, postsynaptic cell membrane, postsynaptic density, synapse, synaptosome

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/46kDa Observed MW: 53kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9463

Uniprot URL

https://www.uniprot.org/uniprot/Q9NRD5

AA Sequence

YLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR44 Blocking Peptide
MBS9622978-01 1 mg

GPR44 Blocking Peptide

Sign In for Pricing
View Details
GPR44 Blocking Peptide
MBS9622978-02 5x 1 mg

GPR44 Blocking Peptide

Sign In for Pricing
View Details
Anti-UBXN1 Antibody Picoband® PE Conjugated
A09683-1-PE 100 µg/Vial

Anti-UBXN1 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Soluble starch synthase, chloroplastic/amyloplastic (At5g24300) , partial
MBS1312070 Inquire

Recombinant Arabidopsis thaliana Soluble starch synthase, chloroplastic/amyloplastic (At5g24300) , partial

Sign In for Pricing
View Details
Recombinant Borrelia Burgdorferi rplE Protein (aa 1-182)
VAng-Lsx1833-1mgEcoli 1 mg (E. coli)

Recombinant Borrelia Burgdorferi rplE Protein (aa 1-182)

Sign In for Pricing
View Details
IKZF1 Antibody
18-345 100 µL

IKZF1 Antibody

Sign In for Pricing
View Details