Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFC Rabbit pAb (APR21728N)

Product Specifications

Background

The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PDGFC Rabbit pAb (APR21728N) .

Synonyms

PDGFC; FALLOTEIN; SCDGF

Gene ID

56034

UniProt

Q9NRA1

Cellular Locus

Cytoplasm, Cytoplasmic granule, Nucleus, Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa/20kDa/31kDa/39kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56034

Uniprot URL

https://www.uniprot.org/uniprot/Q9NRA1

AA Sequence

QFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuromedin U Conjugated Antibody
C47927 100 µL

Neuromedin U Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Enterobacteria phage lambda Minor tail protein M (M)
MBS1125981-01 0.02 mg (E-Coli)

Recombinant Enterobacteria phage lambda Minor tail protein M (M)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage lambda Minor tail protein M (M)
MBS1125981-02 0.1 mg (E-Coli)

Recombinant Enterobacteria phage lambda Minor tail protein M (M)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage lambda Minor tail protein M (M)
MBS1125981-03 0.02 mg (Yeast)

Recombinant Enterobacteria phage lambda Minor tail protein M (M)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage lambda Minor tail protein M (M)
MBS1125981-04 0.1 mg (Yeast)

Recombinant Enterobacteria phage lambda Minor tail protein M (M)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage lambda Minor tail protein M (M)
MBS1125981-05 0.02 mg (Baculovirus)

Recombinant Enterobacteria phage lambda Minor tail protein M (M)

Sign In for Pricing
View Details