Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEN2/PSENEN Rabbit pAb (APR21726N)

Product Specifications

Background

Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2) . Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PEN2/PSENEN Rabbit pAb (APR21726N) .

Synonyms

PSENEN; MDS033; MSTP064; PEN-2; PEN2

Gene ID

55851

UniProt

Q9NZ42

Cellular Locus

Endoplasmic reticulum membrane, Golgi apparatus, Golgi stack membrane, Multi-pass membrane protein

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55851

Uniprot URL

https://www.uniprot.org/uniprot/Q9NZ42

AA Sequence

LGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque ELP6 Protein, His (Fc)-Avi-tagged
ELP6-1280R 50 µg

Recombinant Rhesus Macaque ELP6 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (MaxLight 750)
MBS6374938-01 0.1 mL

CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (MaxLight 750)

Sign In for Pricing
View Details
CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (MaxLight 750)
MBS6374938-02 5x 0.1 mL

CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B) (MaxLight 750)

Sign In for Pricing
View Details
Human COL1A1 (Pro-Collagen I alpha 1) ELISA Kit
EK248541 96 Well

Human COL1A1 (Pro-Collagen I alpha 1) ELISA Kit

Sign In for Pricing
View Details
OCIAD2, 1-154aa, Human, His tag, E Coli (Denatured)
MBS204872-01 0.02 mg

OCIAD2, 1-154aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
OCIAD2, 1-154aa, Human, His tag, E Coli (Denatured)
MBS204872-02 0.1 mg

OCIAD2, 1-154aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details