Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD1 Rabbit pAb (APR21714N)

Product Specifications

Background

The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BTBD1 Rabbit pAb (APR21714N) .

Synonyms

BTBD1; C15orf1; NS5ATP8

Gene ID

53339

UniProt

Q9H0C5

Cellular Locus

Cytoplasm, P-body

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa/52kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=53339

Uniprot URL

https://www.uniprot.org/uniprot/Q9H0C5

AA Sequence

CDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-7678-3p miRNA Agomir
abx884407-01 5 nmol

Mouse mmu-miR-7678-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-7678-3p miRNA Agomir
abx884407-02 10 nmol

Mouse mmu-miR-7678-3p miRNA Agomir

Sign In for Pricing
View Details
GM130 Rabbit Monoclonal Antibody
E28G1078 100 µL

GM130 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TRPV6 Rabbit Polyclonal Antibody
TA338585 100 µL

TRPV6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human GCAT Protein, His, E.coli-5ug
QP11937-5ug 5ug

Recombinant Human GCAT Protein, His, E.coli-5ug

Sign In for Pricing
View Details
CASPASE-12 Antibody
GWB-A00599 0.05 mg

CASPASE-12 Antibody

Sign In for Pricing
View Details