Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD1 Rabbit pAb (APR21714N)

Product Specifications

Background

The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BTBD1 Rabbit pAb (APR21714N) .

Synonyms

BTBD1; C15orf1; NS5ATP8

Gene ID

53339

UniProt

Q9H0C5

Cellular Locus

Cytoplasm, P-body

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa/52kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=53339

Uniprot URL

https://www.uniprot.org/uniprot/Q9H0C5

AA Sequence

CDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPACA4 antibody - N-terminal region (ARP58662_P050)
ARP58662_P050 100 µL

SPACA4 antibody - N-terminal region (ARP58662_P050)

Sign In for Pricing
View Details
MORF4LP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
62101111 3x 1.0 µg

MORF4LP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PLCD4 Antibody
23-220 100 µL

PLCD4 Antibody

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans D1044.5 Polyclonal Antibody
MBS7155756 Inquire

Rabbit anti-Caenorhabditis elegans D1044.5 Polyclonal Antibody

Sign In for Pricing
View Details
NCOR1 ELISA Kit (Human) (OKEH04303)
OKEH04303 96 Well

NCOR1 ELISA Kit (Human) (OKEH04303)

Sign In for Pricing
View Details
FSCN2 antibody
MBS839190-01 0.1 mL

FSCN2 antibody

Sign In for Pricing
View Details