Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A7 Rabbit pAb (APR21687N)

Product Specifications

Background

The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC22A7 Rabbit pAb (APR21687N) .

Synonyms

SLC22A7; NLT; OAT2; hOAT11

Gene ID

10864

UniProt

Q9Y694

Cellular Locus

Basolateral cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/59kDa/60kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10864

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y694

AA Sequence

ALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phyto Pst Agar Base (KBZ Medium)
PHM011-100G 100 g

Phyto Pst Agar Base (KBZ Medium)

Sign In for Pricing
View Details
C15orf53 Recombinant Protein (Human)
RP037192 100 µg

C15orf53 Recombinant Protein (Human)

Sign In for Pricing
View Details
Magnesium L-aspartate dihydrate
454129-01 500 mg

Magnesium L-aspartate dihydrate

Sign In for Pricing
View Details
Magnesium L-aspartate dihydrate
454129-02 1 g

Magnesium L-aspartate dihydrate

Sign In for Pricing
View Details
DKK2 Rabbit Polyclonal Antibody
MBS9514235-01 0.05 mL

DKK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DKK2 Rabbit Polyclonal Antibody
MBS9514235-02 0.1 mL

DKK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details