Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPA33 Rabbit pAb (APR21677N)

Product Specifications

Background

The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GPA33 Rabbit pAb (APR21677N) .

Synonyms

GPA33; A33

Gene ID

10223

UniProt

Q99795

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10223

Uniprot URL

https://www.uniprot.org/uniprot/Q99795

AA Sequence

ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS706664 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
B2
TRC-B820015-5MG 5 mg

B2

Sign In for Pricing
View Details
Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit
RD-TIEG1-Hu-01 96 Tests

Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit

Sign In for Pricing
View Details
Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit
RD-TIEG1-Hu-02 48 Tests

Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Calcitonin/CT protein (TRX, His tag)
PDER100172-01 20 µg

Recombinant Rat Calcitonin/CT protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Rat Calcitonin/CT protein (TRX, His tag)
PDER100172-02 100 µg

Recombinant Rat Calcitonin/CT protein (TRX, His tag)

Sign In for Pricing
View Details