Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF124 Rabbit pAb (APR21661N)

Product Specifications

Background

This gene encodes a protein with an amino-terminal KRAB-A box and multiple repeated Kruppel-type (C2H2) zinc finger motifs at its carboxy terminus. The encoded protein may function as a transcription factor. Expression of this gene is increased after vascular endothelial growth factor (VEGF) stimulation in human leukemia cell lines and results in inhibition of apoptotic cell death induced by irradiation or exposure to etoposide. Alternative splicing results in multiple transcript variants encoding distinct proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF124 Rabbit pAb (APR21661N) .

Synonyms

ZNF124; HZF-16; HZF16; ZK7

Gene ID

7678

UniProt

Q15973

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa/17kDa/33kDa/40kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7678

Uniprot URL

https://www.uniprot.org/uniprot/Q15973

AA Sequence

SIEDQYKNSSRNLRHIISHSGNNPYGCEECGKKPCTCKQCQKTSLSVTRVHRDTVMHTGNGHYGCTICEKVFNIPSSFQIHQRNHTGEKPYECMECGKALGFSRSLNRHKRIHTGEKRYECKQCGKAFSRSSHLRDHERTH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actr8 Mouse Pre-designed siRNA Set A
HY-RS18158 1 Set

Actr8 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
ETS2 Polyclonal Antibody
MBS2565125-01 0.06 mL

ETS2 Polyclonal Antibody

Sign In for Pricing
View Details
ETS2 Polyclonal Antibody
MBS2565125-02 0.12 mL

ETS2 Polyclonal Antibody

Sign In for Pricing
View Details
ETS2 Polyclonal Antibody
MBS2565125-03 0.2 mL

ETS2 Polyclonal Antibody

Sign In for Pricing
View Details
ETS2 Polyclonal Antibody
MBS2565125-04 5x 0.2 mL

ETS2 Polyclonal Antibody

Sign In for Pricing
View Details
OPN1SW Human Gene Knockout Kit (CRISPR)
KN422804 1 Kit

OPN1SW Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details