Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGFR Rabbit pAb (APR21636N)

Product Specifications

Background

The protein encoded by this gene is member of the G-protein coupled receptor family. This protein is a receptor for prostaglandin F2-alpha (PGF2-alpha), which is known to be a potent luteolytic agent, and may also be involved in modulating intraocular pressure and smooth muscle contraction in uterus. Knockout studies in mice suggest that the interaction of PGF2-alpha with this receptor may initiate parturition in ovarian luteal cells and thus induce luteolysis. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PTGFR Rabbit pAb (APR21627N8) .

Synonyms

PTGFR; FP

Gene ID

5737

UniProt

P43088

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/30kDa/32kDa/33kDa/40kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5737

Uniprot URL

https://www.uniprot.org/uniprot/P43088

AA Sequence

ILMKAYQRFRQKSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKPIFHSTKITSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Cys (Acm) Wang Resin LL
HLL0751501307.25G 25 g

Fmoc-Cys (Acm) Wang Resin LL

Sign In for Pricing
View Details
Recombinant Dopamine beta Hydroxylase Monoclonal Antibody
AN301975L-01 50 µL

Recombinant Dopamine beta Hydroxylase Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Dopamine beta Hydroxylase Monoclonal Antibody
AN301975L-02 100 µL

Recombinant Dopamine beta Hydroxylase Monoclonal Antibody

Sign In for Pricing
View Details
Myosin light chain kinase (MYLK) (NM_053031) Human Recombinant Protein
TP318513L 1 mg

Myosin light chain kinase (MYLK) (NM_053031) Human Recombinant Protein

Sign In for Pricing
View Details
Human CCL11/Eotaxin Recombinant Rabbit monoclonal Antibody
HA725198B 100 µL

Human CCL11/Eotaxin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Fmoc-Arg (Pbf) TentaGel® R HMPA Resin
RA1502.5G 5 g

Fmoc-Arg (Pbf) TentaGel® R HMPA Resin

Sign In for Pricing
View Details