Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGAX Rabbit pAb (APR21627N)

Product Specifications

Background

This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as inactivated-C3b (iC3b) receptor 4 (CR4) . The alpha X beta 2 complex seems to overlap the properties of the alpha M beta 2 integrin in the adherence of neutrophils and monocytes to stimulated endothelium cells, and in the phagocytosis of complement coated particles. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ITGAX Rabbit pAb (APR21627N) .

Synonyms

ITGAX; CD11C; SLEB6

Gene ID

3687

UniProt

P20702

Cellular Locus

Membrane, Single-pass type I membrane protein

Applications

IHC (Mus musculus, Rattus norvegicus, Sus scrofa) IF (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 127kDa Observed MW: 150KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3687

Uniprot URL

https://www.uniprot.org/uniprot/P20702

AA Sequence

TSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV695107 1.0 µg DNA

SYT5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Mrgprx2/Mas-related G-protein coupled receptor member X2 ELISA Kit
MBS2904917-01 48 Well

Mouse Mrgprx2/Mas-related G-protein coupled receptor member X2 ELISA Kit

Sign In for Pricing
View Details
Mouse Mrgprx2/Mas-related G-protein coupled receptor member X2 ELISA Kit
MBS2904917-02 96 Well

Mouse Mrgprx2/Mas-related G-protein coupled receptor member X2 ELISA Kit

Sign In for Pricing
View Details
Mouse Mrgprx2/Mas-related G-protein coupled receptor member X2 ELISA Kit
MBS2904917-03 5x 96 Well

Mouse Mrgprx2/Mas-related G-protein coupled receptor member X2 ELISA Kit

Sign In for Pricing
View Details
Mouse Mrgprx2/Mas-related G-protein coupled receptor member X2 ELISA Kit
MBS2904917-04 10x 96 Well

Mouse Mrgprx2/Mas-related G-protein coupled receptor member X2 ELISA Kit

Sign In for Pricing
View Details
RIMBP3 siRNA (Human)
CRJ3791-01 15 nmol

RIMBP3 siRNA (Human)

Sign In for Pricing
View Details