Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTC4S Rabbit pAb (APR21618N)

Product Specifications

Background

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LTC4S Rabbit pAb (APR21618N) .

Synonyms

LTC4S

Gene ID

4056

UniProt

Q16873

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein, Nucleus outer membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 17kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4056

Uniprot URL

https://www.uniprot.org/uniprot/Q16873

AA Sequence

YRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Hormone sensitive lipase (S660) Recombinant Rabbit monoclonal Antibody
HA723195 100 µL

Phospho-Hormone sensitive lipase (S660) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), 0.2mg/mL
BNUB0988-100 1x 100 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), 0.2mg/mL

Sign In for Pricing
View Details
GMEB1 (NM_006582) Human Recombinant Protein
TP317117M 100 µg

GMEB1 (NM_006582) Human Recombinant Protein

Sign In for Pricing
View Details
Human SIRP alpha Recombinant Rabbit monoclonal Antibody
HA725348 100 µL

Human SIRP alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: right
CP565650 150 µg

Tissue Protein Lysate, Colon: right

Sign In for Pricing
View Details
Mouse Cct4 activation kit by CRISPRa
GA200594 1 Kit

Mouse Cct4 activation kit by CRISPRa

Sign In for Pricing
View Details