Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTC4S Rabbit pAb (APR21618N)

Product Specifications

Background

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LTC4S Rabbit pAb (APR21618N) .

Synonyms

LTC4S

Gene ID

4056

UniProt

Q16873

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein, Nucleus outer membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 17kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4056

Uniprot URL

https://www.uniprot.org/uniprot/Q16873

AA Sequence

YRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin C (SCG2) Mouse Monoclonal Antibody [Clone ID: OTI2B2]
CF811869 100 µg

Chromogranin C (SCG2) Mouse Monoclonal Antibody [Clone ID: OTI2B2]

Sign In for Pricing
View Details
Cooled Incubator BICL-6108
BICL-6108 1 Unit

Cooled Incubator BICL-6108

Sign In for Pricing
View Details
ZNF539 (ZNF254) (NM_001278678) Human Tagged ORF Clone
RG238950 10 µg

ZNF539 (ZNF254) (NM_001278678) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human CDRT15 activation kit by CRISPRa
GA115580 1 Kit

Human CDRT15 activation kit by CRISPRa

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), Biotin conjugate, 0.1mg/mL
BNCB1071-100 1x 100 µL

Ksp-Cadherin / CDH16 (CDH16/1071), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]
TA809373AM 100 µL

Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]

Sign In for Pricing
View Details