Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP4 Rabbit pAb (APR21615N)

Product Specifications

Background

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IGFBP4 Rabbit pAb (APR21615N) .

Synonyms

IGFBP4; BP-4; HT29-IGFBP; IBP4; IGFBP-4

Gene ID

3487

UniProt

P22692

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/27kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3487

Uniprot URL

https://www.uniprot.org/uniprot/P22692

AA Sequence

LHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Polyclonal anti-Human CD72
hAP-5746 50 µg

Sheep Polyclonal anti-Human CD72

Sign In for Pricing
View Details
NANOGP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
31425111 3x 1.0 µg

NANOGP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MIP3B, NT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (P
MBS6486010-01 0.2 mL

MIP3B, NT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (P

Sign In for Pricing
View Details
MIP3B, NT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (P
MBS6486010-02 5x 0.2 mL

MIP3B, NT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (P

Sign In for Pricing
View Details
Rat Protein Kinase C Delta (PRKCD) ELISA Kit
abx155979-01 96 Tests

Rat Protein Kinase C Delta (PRKCD) ELISA Kit

Sign In for Pricing
View Details
Rat Protein Kinase C Delta (PRKCD) ELISA Kit
abx155979-02 5x 96 Tests

Rat Protein Kinase C Delta (PRKCD) ELISA Kit

Sign In for Pricing
View Details