Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP11B1 Rabbit pAb (APR21593N)

Product Specifications

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYP11B1 Rabbit pAb (APR21593N) .

Synonyms

CYP11B1; CPN1; CYP11B; FHI; P450C11

Gene ID

1584

UniProt

P15538

Cellular Locus

Mitochondrion membrane

Dilution

IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa/57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1584

Uniprot URL

https://www.uniprot.org/uniprot/P15538

AA Sequence

TVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BRCA1 (NM_007294) Human Mutant ORF Clone
RC403134 10 µg

BRCA1 (NM_007294) Human Mutant ORF Clone

Ask
View Details
PRRG3, ID (PRRG3, PRGP3, TMG3, Transmembrane gamma-carboxyglutamic acid protein 3, Proline-rich gamma-carboxyglutamic acid protein 3)
MBS647333-01 0.2 mL

PRRG3, ID (PRRG3, PRGP3, TMG3, Transmembrane gamma-carboxyglutamic acid protein 3, Proline-rich gamma-carboxyglutamic acid protein 3)

Ask
View Details
PRRG3, ID (PRRG3, PRGP3, TMG3, Transmembrane gamma-carboxyglutamic acid protein 3, Proline-rich gamma-carboxyglutamic acid protein 3)
MBS647333-02 5x 0.2 mL

PRRG3, ID (PRRG3, PRGP3, TMG3, Transmembrane gamma-carboxyglutamic acid protein 3, Proline-rich gamma-carboxyglutamic acid protein 3)

Ask
View Details
Uridine Monophosphate Kinase 2, NT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (FITC)
MBS6504884-01 0.2 mL

Uridine Monophosphate Kinase 2, NT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (FITC)

Ask
View Details
Uridine Monophosphate Kinase 2, NT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (FITC)
MBS6504884-02 5x 0.2 mL

Uridine Monophosphate Kinase 2, NT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (FITC)

Ask
View Details
Elafin (H-2) Alexa Fluor® 546
sc-398075 AF546 200 µg/mL

Elafin (H-2) Alexa Fluor® 546

Ask
View Details