Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXN3 Rabbit pAb (APR21586N)

Product Specifications

Background

This gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FOXN3 Rabbit pAb (APR21586N) .

Synonyms

FOXN3; C14orf116; CHES1; PRO1635

Gene ID

1112

UniProt

O00409

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/53kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1112

Uniprot URL

https://www.uniprot.org/uniprot/O00409

AA Sequence

VRPLPITPIGVTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSPTSDSISSSSSSADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKGQKEQKETTKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Danio rerio (Zebrafish) Opn1sw2 Antibody HRP Conjugated
orb3166349 200 µL

Danio rerio (Zebrafish) Opn1sw2 Antibody HRP Conjugated

Sign In for Pricing
View Details
DNM1P25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0619908 1.0 µg DNA

DNM1P25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Forkhead box protein I3 (FOXI3) ELISA Kit
abx524196 96 Tests

Human Forkhead box protein I3 (FOXI3) ELISA Kit

Sign In for Pricing
View Details
EPCAM Mouse Monoclonal Antibody [Clone ID: OTI8A9]
TA809211S 30 µL

EPCAM Mouse Monoclonal Antibody [Clone ID: OTI8A9]

Sign In for Pricing
View Details
Senataxin (Probable Helicase Senataxin, SETX, Amyotrophic Lateral Sclerosis 4 Protein, ALS4, AOA2, bA479K20.2, KIAA0625, SCAR1, SEN1 Homolog) (PE)
133213-PE 100 µL

Senataxin (Probable Helicase Senataxin, SETX, Amyotrophic Lateral Sclerosis 4 Protein, ALS4, AOA2, bA479K20.2, KIAA0625, SCAR1, SEN1 Homolog) (PE)

Sign In for Pricing
View Details
REXO1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38840064 1.0 µg DNA

REXO1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details