Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT2 Rabbit pAb (APR21547N)

Product Specifications

Background

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STAT2 Rabbit pAb (APR21547N) .

Synonyms

STAT2; IMD44; ISGF-3; P113; STAT113

Gene ID

6773

UniProt

P52630

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 97kDa Observed MW: 113KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6773

Uniprot URL

https://www.uniprot.org/uniprot/P52630

AA Sequence

LLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttc1 (NM_001005529) Rat Untagged Clone
RN215140 10 µg

Ttc1 (NM_001005529) Rat Untagged Clone

Sign In for Pricing
View Details
HIST2H2AA4 sgRNA CRISPR Lentivector (Human) (Target 3)
K0960304 1.0 µg DNA

HIST2H2AA4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
[KO Validated] RBM3 Rabbit pAb
MBS9144432-01 0.02 mL

[KO Validated] RBM3 Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] RBM3 Rabbit pAb
MBS9144432-02 0.1 mL

[KO Validated] RBM3 Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] RBM3 Rabbit pAb
MBS9144432-03 5x 0.1 mL

[KO Validated] RBM3 Rabbit pAb

Sign In for Pricing
View Details
Trim36 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4847603 1.0 µg DNA

Trim36 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details