Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRED1 Rabbit pAb (APR21524N)

Product Specifications

Background

The protein encoded by this gene is a member of the Sprouty family of proteins and is phosphorylated by tyrosine kinase in response to several growth factors. The encoded protein can act as a homodimer or as a heterodimer with SPRED2 to regulate activation of the MAP kinase cascade. Defects in this gene are a cause of neurofibromatosis type 1-like syndrome (NFLS) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPRED1 Rabbit pAb (APR21524N) .

Synonyms

SPRED1; NFLS; PPP1R147; hSpred1; spred-1

Gene ID

161742

UniProt

Q7Z699

Cellular Locus

Cell membrane, Membrane, Nucleus, Peripheral membrane protein, caveola

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=161742

Uniprot URL

https://www.uniprot.org/uniprot/Q7Z699

AA Sequence

IEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppme1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6404307 1.0 µg DNA

Ppme1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Klk1c2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6800708 1.0 µg DNA

Klk1c2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Fasudil, Monohydrochloride Salt
sc-203418F 10 g

Fasudil, Monohydrochloride Salt

Sign In for Pricing
View Details
UNGP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV755228 1.0 µg DNA

UNGP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Blochmannia pennsylvanicus Urease accessory protein UreF (ureF)
MBS1443155-01 0.02 mg (E-Coli)

Recombinant Blochmannia pennsylvanicus Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Blochmannia pennsylvanicus Urease accessory protein UreF (ureF)
MBS1443155-02 0.1 mg (E-Coli)

Recombinant Blochmannia pennsylvanicus Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details