Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM3 Rabbit pAb (APR21496N)

Product Specifications

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. A mutation in an intron of this gene is associated with hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality JAM3 Rabbit pAb (APR21496N) .

Synonyms

JAM3; JAM-2; JAM-3; JAM-C; JAMC

Gene ID

83700

UniProt

Q9BX67

Cellular Locus

Cell junction, Cell membrane, Secreted, Single-pass type I membrane protein, desmosome, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/35kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=83700

Uniprot URL

https://www.uniprot.org/uniprot/Q9BX67

AA Sequence

MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK2 (MAPK1) Rabbit Polyclonal Antibody
TA378293 100 µL

ERK2 (MAPK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BVDV Glycoprotein E1/gp33 Polyclonal Antibody
E55A05374 100 µg

BVDV Glycoprotein E1/gp33 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Phytophthora capsici Alpha-elicitin capsicein
MBS1080560-01 0.02 mg (E-Coli)

Recombinant Phytophthora capsici Alpha-elicitin capsicein

Sign In for Pricing
View Details
Recombinant Phytophthora capsici Alpha-elicitin capsicein
MBS1080560-02 0.1 mg (E-Coli)

Recombinant Phytophthora capsici Alpha-elicitin capsicein

Sign In for Pricing
View Details
Recombinant Phytophthora capsici Alpha-elicitin capsicein
MBS1080560-03 0.02 mg (Yeast)

Recombinant Phytophthora capsici Alpha-elicitin capsicein

Sign In for Pricing
View Details
Recombinant Phytophthora capsici Alpha-elicitin capsicein
MBS1080560-04 0.1 mg (Yeast)

Recombinant Phytophthora capsici Alpha-elicitin capsicein

Sign In for Pricing
View Details