Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XPNPEP3 Rabbit pAb (APR21472N)

Product Specifications

Background

The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality XPNPEP3 Rabbit pAb (APR21472N) .

Synonyms

XPNPEP3; APP3; ICP55; NPHPL1

Gene ID

63929

UniProt

Q9NQH7

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/32kDa/48kDa/54kDa/57kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=63929

Uniprot URL

https://www.uniprot.org/uniprot/Q9NQH7

AA Sequence

MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR1B (Activin A Receptor, Type IB, ACTRIB, ACVRLK4, ALK4, SKR2) (MaxLight 750)
MBS6236756-01 0.1 mL

ACVR1B (Activin A Receptor, Type IB, ACTRIB, ACVRLK4, ALK4, SKR2) (MaxLight 750)

Sign In for Pricing
View Details
ACVR1B (Activin A Receptor, Type IB, ACTRIB, ACVRLK4, ALK4, SKR2) (MaxLight 750)
MBS6236756-02 5x 0.1 mL

ACVR1B (Activin A Receptor, Type IB, ACTRIB, ACVRLK4, ALK4, SKR2) (MaxLight 750)

Sign In for Pricing
View Details
Casein Kinase I Isoform Alpha and Alpha-Like (CSNK1A1L/CSNK1A1) Antibody
abx326760-01 50 µg

Casein Kinase I Isoform Alpha and Alpha-Like (CSNK1A1L/CSNK1A1) Antibody

Sign In for Pricing
View Details
Casein Kinase I Isoform Alpha and Alpha-Like (CSNK1A1L/CSNK1A1) Antibody
abx326760-02 100 µg

Casein Kinase I Isoform Alpha and Alpha-Like (CSNK1A1L/CSNK1A1) Antibody

Sign In for Pricing
View Details
PRKAG1 (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK gamma1, AMPK Subunit gamma-1, AMPKg, AMPKG, MGC8666) (AP)
MBS6390648-01 0.1 mL

PRKAG1 (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK gamma1, AMPK Subunit gamma-1, AMPKg, AMPKG, MGC8666) (AP)

Sign In for Pricing
View Details
PRKAG1 (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK gamma1, AMPK Subunit gamma-1, AMPKg, AMPKG, MGC8666) (AP)
MBS6390648-02 5x 0.1 mL

PRKAG1 (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK gamma1, AMPK Subunit gamma-1, AMPKg, AMPKG, MGC8666) (AP)

Sign In for Pricing
View Details