Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIPAS39 Rabbit pAb (APR21471N)

Product Specifications

Background

This gene encodes a protein involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2) . Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VIPAS39 Rabbit pAb (APR21471N) .

Synonyms

VIPAS39; C14orf133; SPE-39; SPE39; VIPAR; VPS16B; hSPE-39

Gene ID

63894

UniProt

Q9H9C1

Cellular Locus

Cytoplasm, Cytoplasmic vesicle, Early endosome, Late endosome, Recycling endosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/57kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=63894

Uniprot URL

https://www.uniprot.org/uniprot/Q9H9C1

AA Sequence

MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APP, ID (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amyloid protein 40, Beta-APP40, C83, P3 (42), P3 (40), C80, Gamma-secretase C-terminal fragment 59, Amyloid intracellular domain 59, Gamma-CTF (59), Gamma-secretase C-terminal fragment 57, Amyloid intracellular domain 57, Gamma-CTF (57), Gamma-secretase C-terminal fragment 50, Amyloid intracellular domain 50, Gamma-CTF (50), C31) (MaxLight 750) discontinued
031996-ML750 100 µL

APP, ID (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amyloid protein 40, Beta-APP40, C83, P3 (42), P3 (40), C80, Gamma-secretase C-terminal fragment 59, Amyloid intracellular domain 59, Gamma-CTF (59), Gamma-secretase C-terminal fragment 57, Amyloid intracellular domain 57, Gamma-CTF (57), Gamma-secretase C-terminal fragment 50, Amyloid intracellular domain 50, Gamma-CTF (50), C31) (MaxLight 750) discontinued

Ask
View Details
UPP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11F11]
TA812318AM 100 µL

UPP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11F11]

Ask
View Details
TRPM4 Polyclonal Antibody, PerCP Conjugated
bs-9051R-PerCP 100 µL

TRPM4 Polyclonal Antibody, PerCP Conjugated

Ask
View Details
Rabbit anti Human CPE  Monoclonal Antibody
MBS2543830-01 0.06 mL

Rabbit anti Human CPE  Monoclonal Antibody

Ask
View Details
Rabbit anti Human CPE  Monoclonal Antibody
MBS2543830-02 0.12 mL

Rabbit anti Human CPE  Monoclonal Antibody

Ask
View Details
Rabbit anti Human CPE  Monoclonal Antibody
MBS2543830-03 0.2 mL

Rabbit anti Human CPE  Monoclonal Antibody

Ask
View Details