Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO42 Rabbit pAb (APR21451N)

Product Specifications

Background

Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (SKP1A; MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]) .[supplied by OMIM, Dec 2010]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FBXO42 Rabbit pAb (APR21451N) .

Synonyms

FBXO42; Fbx42; JFK

Gene ID

54455

UniProt

Q6P3S6

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa Observed MW: 78kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54455

Uniprot URL

https://www.uniprot.org/uniprot/Q6P3S6

AA Sequence

PSAPEGYDLKIGLSLAPRRGSLPDQKDLRLGSIDLNWDLKPASSSNPMDGMDNRTVGGSMRHPPEQTNGVHTPPHVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPIPRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB3P16 Protein Vector (Human) (pPM-C-His)
PV083560 500 ng

HMGB3P16 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
BMH-21 25mg
A14335-25 25 mg

BMH-21 25mg

Sign In for Pricing
View Details
MMP7 Mouse Monoclonal Antibody [Clone ID: LBI3E9]
AMM16683V 100 µL

MMP7 Mouse Monoclonal Antibody [Clone ID: LBI3E9]

Sign In for Pricing
View Details
MIR674 Rat qPCR Template Standard (MI0006159)
RK300382 200 Reactions

MIR674 Rat qPCR Template Standard (MI0006159)

Sign In for Pricing
View Details
Mouse Monoclonal SLA2 Antibody (OTI3A7) [Alexa Fluor 750]
NBP2-74210AF750 0.1 mL

Mouse Monoclonal SLA2 Antibody (OTI3A7) [Alexa Fluor 750]

Sign In for Pricing
View Details
CD1A Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-60907R-BF594 100 µL

CD1A Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details