Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO42 Rabbit pAb (APR21451N)

Product Specifications

Background

Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (SKP1A; MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]) .[supplied by OMIM, Dec 2010]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FBXO42 Rabbit pAb (APR21451N) .

Synonyms

FBXO42; Fbx42; JFK

Gene ID

54455

UniProt

Q6P3S6

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa Observed MW: 78kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54455

Uniprot URL

https://www.uniprot.org/uniprot/Q6P3S6

AA Sequence

PSAPEGYDLKIGLSLAPRRGSLPDQKDLRLGSIDLNWDLKPASSSNPMDGMDNRTVGGSMRHPPEQTNGVHTPPHVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPIPRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Programmed cell death protein ELISA kit
QY-E11883 96 Tests

Rat Programmed cell death protein ELISA kit

Sign In for Pricing
View Details
ZFHX1B (Zinc Finger E-Box Binding HomeoBox 2, KIAA0569, SIP-1, SIP1, SMADIP1, ZFHX1B) (MaxLight 750) discontinued
253583-ML750 100 µL

ZFHX1B (Zinc Finger E-Box Binding HomeoBox 2, KIAA0569, SIP-1, SIP1, SMADIP1, ZFHX1B) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Azurocidin (AZU) Monoclonal Antibody
CAU33905-01 100 µL

Azurocidin (AZU) Monoclonal Antibody

Sign In for Pricing
View Details
Azurocidin (AZU) Monoclonal Antibody
CAU33905-02 200 µL

Azurocidin (AZU) Monoclonal Antibody

Sign In for Pricing
View Details
Azurocidin (AZU) Monoclonal Antibody
CAU33905-03 1 mL

Azurocidin (AZU) Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral human C7orf31 shRNA (UAS) - Lentiviral human C7orf31 shRNA (UAS, GFP) (25)
GTR15090164 1 Vial

Lentiviral human C7orf31 shRNA (UAS) - Lentiviral human C7orf31 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details