Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL1 Rabbit pAb (APR21445N)

Product Specifications

Background

This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases) . The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PPIL1 Rabbit pAb (APR21445N) .

Synonyms

PPIL1; CGI-124; CYPL1; PPIase; hCyPX

Gene ID

51645

UniProt

Q9Y3C6

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51645

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y3C6

AA Sequence

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Antibody
orb685572 100 µL

AKT1 Antibody

Sign In for Pricing
View Details
CCDC80 AAV Vector (Human) (CMV)
15312101 1 µg

CCDC80 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
OTUD3, ID (OTUD3, KIAA0459, OTU domain-containing protein 3)
039538 200 µL

OTUD3, ID (OTUD3, KIAA0459, OTU domain-containing protein 3)

Sign In for Pricing
View Details
Mouse Monoclonal MUC2 Antibody (rMLP/842) [Alexa Fluor 750]
NBP3-08239AF750 100 µL

Mouse Monoclonal MUC2 Antibody (rMLP/842) [Alexa Fluor 750]

Sign In for Pricing
View Details
IL-16/Il16/IL Rabbit Polyclonal Antibody (HRP)
orb2615230 100 µg

IL-16/Il16/IL Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
DCT CRISPR All-in-one AAV vector set (with saCas9)(Human)
17748151 3x 1.0 µg DNA

DCT CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details