Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC40A1 Rabbit pAb (APR21436N)

Product Specifications

Background

The protein encoded by this gene is a cell membrane protein that may be involved in iron export from duodenal epithelial cells. Defects in this gene are a cause of hemochromatosis type 4 (HFE4) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC40A1 Rabbit pAb (APR21436N) .

Synonyms

SLC40A1; FPN1; HFE4; IREG1; MST079; MSTP079; MTP1; SLC11A3

Gene ID

30061

UniProt

Q9NP59

Cellular Locus

Cell membrane, Multi-pass membrane protein

Applications

WB (Homo sapiens, Rattus norvegicus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 62kDa Observed MW: 63KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=30061

Uniprot URL

https://www.uniprot.org/uniprot/Q9NP59

AA Sequence

SPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLMAP Rabbit Polyclonal Antibody
orb258250 100 µg

SLMAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Geobacillus stearothermophilus (Bacillus stearothermophilus) rplR Polyclonal Antibody
MBS7162476 Inquire

Rabbit anti-Geobacillus stearothermophilus (Bacillus stearothermophilus) rplR Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae UTH1 Protein (aa 18-362) [His] (strain YJM789)
VAng-Wyb6151-1mg 1 mg

Recombinant Saccharomyces Cerevisiae UTH1 Protein (aa 18-362) [His] (strain YJM789)

Sign In for Pricing
View Details
Olfr1198 (NM_207567) Mouse Tagged ORF Clone Lentiviral Particle
MR213226L3V 200 µL

Olfr1198 (NM_207567) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Actin Alpha 1, Cardiac Muscle (ACTC1) Antibody
abx132235-01 100 µL

Actin Alpha 1, Cardiac Muscle (ACTC1) Antibody

Sign In for Pricing
View Details
Actin Alpha 1, Cardiac Muscle (ACTC1) Antibody
abx132235-02 200 µL

Actin Alpha 1, Cardiac Muscle (ACTC1) Antibody

Sign In for Pricing
View Details