Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR182 Rabbit pAb (APR21405N)

Product Specifications

Background

Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin.

Synonyms

GPR182; 7TMR; ADMR; AM-R; AMR; G10D; gamrh; hrhAMR

Gene ID

11318

UniProt

O15218

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GPR182 Rabbit pAb (APR21405N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11318

Uniprot URL

https://www.uniprot.org/uniprot/O15218

AA Sequence

QPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WDFY1 Blocking Peptide
33R-5591 100 ug

WDFY1 Blocking Peptide

Ask
View Details
LOX1 (LOX-1, hLOX-1, C-type Lectin Domain Family 8 Member A, CLEC8A, Lectin-like Oxidized LDL Receptor 1, Lectin-like oxLDL Receptor 1, Lectin-type Oxidized LDL Receptor 1, LOXIN, Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, OLR1, SCARE
MBS6251981-01 0.1 mL

LOX1 (LOX-1, hLOX-1, C-type Lectin Domain Family 8 Member A, CLEC8A, Lectin-like Oxidized LDL Receptor 1, Lectin-like oxLDL Receptor 1, Lectin-type Oxidized LDL Receptor 1, LOXIN, Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, OLR1, SCARE

Ask
View Details
LOX1 (LOX-1, hLOX-1, C-type Lectin Domain Family 8 Member A, CLEC8A, Lectin-like Oxidized LDL Receptor 1, Lectin-like oxLDL Receptor 1, Lectin-type Oxidized LDL Receptor 1, LOXIN, Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, OLR1, SCARE
MBS6251981-02 5x 0.1 mL

LOX1 (LOX-1, hLOX-1, C-type Lectin Domain Family 8 Member A, CLEC8A, Lectin-like Oxidized LDL Receptor 1, Lectin-like oxLDL Receptor 1, Lectin-type Oxidized LDL Receptor 1, LOXIN, Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, OLR1, SCARE

Ask
View Details
Anti-PU.1/SPI1 Antibody Picoband®
A01116-1 100 μg/Vial

Anti-PU.1/SPI1 Antibody Picoband®

Ask
View Details