Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR9 Rabbit pAb (APR21400N)

Product Specifications

Background

The protein encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to the chemokine receptor gene cluster region. Two alternatively spliced transcript variants have been described. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCR9 Rabbit pAb (APR21400N) .

Synonyms

CCR9; CC-CKR-9; CDw199; GPR-9-6; GPR28

Gene ID

10803

UniProt

P51686

Cellular Locus

Cell membrane, Multi-pass membrane protein

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa/42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10803

Uniprot URL

https://www.uniprot.org/uniprot/P51686

AA Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42, Human
LF-P0143 0.2 mg

CDC42, Human

Sign In for Pricing
View Details
IRF6 Antibody
orb3052877-01 30 µL

IRF6 Antibody

Sign In for Pricing
View Details
IRF6 Antibody
orb3052877-02 50 µL

IRF6 Antibody

Sign In for Pricing
View Details
IRF6 Antibody
orb3052877-03 100 µL

IRF6 Antibody

Sign In for Pricing
View Details
AP2A1 Antibody
MBS8501940-01 0.1 mg

AP2A1 Antibody

Sign In for Pricing
View Details
AP2A1 Antibody
MBS8501940-02 0.1 mL (AF405L)

AP2A1 Antibody

Sign In for Pricing
View Details