Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBP Rabbit pAb (APR21397N)

Product Specifications

Background

The protein encoded by this gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EBP Rabbit pAb (APR21397N) .

Synonyms

EBP; CDPX2; CHO2; CPX; CPXD; MEND

Gene ID

10682

UniProt

Q15125

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10682

Uniprot URL

https://www.uniprot.org/uniprot/Q15125

AA Sequence

SGRAAVVPLGTWRRLSLCWFAVCGFIHLVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITACLWGPLSLWVVIAFLRQHPLRFIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1682505 3x 1.0 µg

POLR1C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Bovine Olfactory receptor 2G6 (OR2G6) ELISA Kit
MBS7210744-01 48 Well

Bovine Olfactory receptor 2G6 (OR2G6) ELISA Kit

Sign In for Pricing
View Details
Bovine Olfactory receptor 2G6 (OR2G6) ELISA Kit
MBS7210744-02 96 Well

Bovine Olfactory receptor 2G6 (OR2G6) ELISA Kit

Sign In for Pricing
View Details
Bovine Olfactory receptor 2G6 (OR2G6) ELISA Kit
MBS7210744-03 5x 96 Well

Bovine Olfactory receptor 2G6 (OR2G6) ELISA Kit

Sign In for Pricing
View Details
Bovine Olfactory receptor 2G6 (OR2G6) ELISA Kit
MBS7210744-04 10x 96 Well

Bovine Olfactory receptor 2G6 (OR2G6) ELISA Kit

Sign In for Pricing
View Details
Human CFHR2 HEK293 Overexpression Lysate
MBS8115305-01 0.3 mg

Human CFHR2 HEK293 Overexpression Lysate

Sign In for Pricing
View Details