Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGMAR1 Rabbit pAb (APR21389N)

Product Specifications

Background

This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SIGMAR1 Rabbit pAb (APR21389N) .

Synonyms

SIGMAR1; ALS16; DSMA2; OPRS1; SIG-1R; SR-BP; SR-BP1; SRBP; hSigmaR1; sigma1R

Gene ID

10280

UniProt

Q99720

Cellular Locus

Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum membrane, Lipid droplet, Nucleus inner membrane, Nucleus outer membrane, growth cone

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa/21kDa/22kDa/25kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10280

Uniprot URL

https://www.uniprot.org/uniprot/Q99720

AA Sequence

GTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC45A1 Human shRNA Lentiviral Particle (Locus ID 50651)
TL301558V 500 µL Each

SLC45A1 Human shRNA Lentiviral Particle (Locus ID 50651)

Sign In for Pricing
View Details
NAF1 Protein Vector (Rat) (pPM-C-HA)
31397026 500 ng

NAF1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
MK2206 (Akt inhibitor)
SF2712-25mg 25 mg

MK2206 (Akt inhibitor)

Sign In for Pricing
View Details
Mouse Monoclonal STING/TMEM173 Antibody (723505) [mFluor Violet 500 SE]
FAB7169MFV500 0.1 mL

Mouse Monoclonal STING/TMEM173 Antibody (723505) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Polyclonal TSHZ1 Antibody
APR06746G 0.1 mg

Polyclonal TSHZ1 Antibody

Sign In for Pricing
View Details
pUNO1-mTNF
puno1-mtnf 20 µg

pUNO1-mTNF

Sign In for Pricing
View Details