Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGMAR1 Rabbit pAb (APR21389N)

Product Specifications

Background

This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SIGMAR1 Rabbit pAb (APR21389N) .

Synonyms

SIGMAR1; ALS16; DSMA2; OPRS1; SIG-1R; SR-BP; SR-BP1; SRBP; hSigmaR1; sigma1R

Gene ID

10280

UniProt

Q99720

Cellular Locus

Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum membrane, Lipid droplet, Nucleus inner membrane, Nucleus outer membrane, growth cone

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa/21kDa/22kDa/25kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10280

Uniprot URL

https://www.uniprot.org/uniprot/Q99720

AA Sequence

GTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL28 Antibody
MBS8596217-01 0.1 mg

RPL28 Antibody

Sign In for Pricing
View Details
RPL28 Antibody
MBS8596217-02 0.1 mL (AF405L)

RPL28 Antibody

Sign In for Pricing
View Details
RPL28 Antibody
MBS8596217-03 0.1 mL (AF405S)

RPL28 Antibody

Sign In for Pricing
View Details
RPL28 Antibody
MBS8596217-04 0.1 mL (AF610)

RPL28 Antibody

Sign In for Pricing
View Details
RPL28 Antibody
MBS8596217-05 0.1 mL (AF635)

RPL28 Antibody

Sign In for Pricing
View Details
RPL28 Antibody
MBS8596217-06 0.1 mL (APC)

RPL28 Antibody

Sign In for Pricing
View Details