Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLK1 Rabbit pAb (APR21383N)

Product Specifications

Background

The protein encoded by this gene is a serine/threonine kinase that may be involved in the regulation of chromatin assembly. The encoded protein is only active when it is phosphorylated, and this phosphorylation is cell cycle-dependent, with the maximal activity of this protein coming during S phase. The catalytic activity of this protein is diminished by DNA damage and by blockage of DNA replication. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TLK1 Rabbit pAb (APR21383N) .

Synonyms

TLK1; PKU-beta

Gene ID

9874

UniProt

Q9UKI8

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 63kDa/77kDa/81kDa/86kDa/89kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9874

Uniprot URL

https://www.uniprot.org/uniprot/Q9UKI8

AA Sequence

PVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

W/W030/EN513-ALU05-120X50/1-B AC Signs
302847 Pack of 1 Pictogram(s)

W/W030/EN513-ALU05-120X50/1-B AC Signs

Sign In for Pricing
View Details
CTLA-4 (E2V1Z) & CO-0078-488 SignalStar™ Oligo-Antibody Pair
CST 85716S 1 Kit

CTLA-4 (E2V1Z) & CO-0078-488 SignalStar™ Oligo-Antibody Pair

Sign In for Pricing
View Details
RN5S232 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV744174 1.0 µg DNA

RN5S232 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse Anti-Human Ig kappa chain Antibody (AF532)
abx142749-01 100 µL

Mouse Anti-Human Ig kappa chain Antibody (AF532)

Sign In for Pricing
View Details
Mouse Anti-Human Ig kappa chain Antibody (AF532)
abx142749-02 500 µL

Mouse Anti-Human Ig kappa chain Antibody (AF532)

Sign In for Pricing
View Details
Mouse Anti-Human Ig kappa chain Antibody (AF532)
abx142749-03 1 mL

Mouse Anti-Human Ig kappa chain Antibody (AF532)

Sign In for Pricing
View Details