Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF4B Rabbit pAb (APR21366N)

Product Specifications

Background

Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs) . This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRPF4B Rabbit pAb (APR21366N) .

Synonyms

PRPF4B; PR4H; PRP4; PRP4H; PRP4K; dJ1013A10.1

Gene ID

8899

UniProt

Q13523

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 116kDa Observed MW: 160kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8899

Uniprot URL

https://www.uniprot.org/uniprot/Q13523

AA Sequence

QKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THYN1 Polyclonal Antibody, Cy5.5 Conjugated
bs-7104R-Cy5.5 100 µL

THYN1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
BSEP Antibody / Bile Salt Export Pump / ABCB11
orb1823840 100 µg

BSEP Antibody / Bile Salt Export Pump / ABCB11

Sign In for Pricing
View Details
Acetoacetyl CoA synthetase (AACS) Human shRNA Lentiviral Particle (Locus ID 65985)
TL306936V 500 µL Each

Acetoacetyl CoA synthetase (AACS) Human shRNA Lentiviral Particle (Locus ID 65985)

Sign In for Pricing
View Details
Rat Coagulation Factor 8 (F8) Protein
abx658422-01 10 µg

Rat Coagulation Factor 8 (F8) Protein

Sign In for Pricing
View Details
Rat Coagulation Factor 8 (F8) Protein
abx658422-02 50 µg

Rat Coagulation Factor 8 (F8) Protein

Sign In for Pricing
View Details
Rat Coagulation Factor 8 (F8) Protein
abx658422-03 100 µg

Rat Coagulation Factor 8 (F8) Protein

Sign In for Pricing
View Details