Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F8A1 Rabbit pAb (APR21357N)

Product Specifications

Background

This gene is contained entirely within intron 22 of the factor VIII gene; spans less than 2 kb, and is transcribed in the direction opposite of factor VIII. A portion of intron 22 (int22h), containing F8A, is repeated twice extragenically closer to the Xq telomere. Although its function is unknown, the observation that this gene is conserved in the mouse implies it has some function. Unlike factor VIII, this gene is transcribed abundantly in a wide variety of cell types.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality F8A1 Rabbit pAb (APR21357N) .

Synonyms

F8A1; DXS522E; F8A; HAP40

Gene ID

8263

UniProt

P23610

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8263

Uniprot URL

https://www.uniprot.org/uniprot/P23610

AA Sequence

AALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRLAREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP7 Antibody
GWB-MV462C 50 µg

CASP7 Antibody

Sign In for Pricing
View Details
AA(Arachidonic Acid) ELISA Kit
YPJ1131-01 48 Well

AA(Arachidonic Acid) ELISA Kit

Sign In for Pricing
View Details
AA(Arachidonic Acid) ELISA Kit
YPJ1131-02 96 Well

AA(Arachidonic Acid) ELISA Kit

Sign In for Pricing
View Details
Nefopam N-oxide
285112-01 5 mg

Nefopam N-oxide

Sign In for Pricing
View Details
Nefopam N-oxide
285112-02 10 mg

Nefopam N-oxide

Sign In for Pricing
View Details
Nefopam N-oxide
285112-03 25 mg

Nefopam N-oxide

Sign In for Pricing
View Details