Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXK Rabbit pAb (APR21342N)

Product Specifications

Background

Non-receptor tyrosine kinase that plays a redundant role with ITK in regulation of the adaptive immune response. Regulates the development, function and differentiation of conventional T-cells and nonconventional NKT-cells. When antigen presenting cells (APC activate T-cell receptor (TCR, a series of phosphorylation leads to the recruitment of TXK to the cell membrane, where it is phosphorylated at Tyr-420. Phosphorylation leads to TXK full activation. Contributes also to signaling from many receptors and participates in multiple downstream pathways, including regulation of the actin cytoskeleton. Like ITK, can phosphorylate PLCG1, leading to its localization in lipid rafts and activation, followed by subsequent cleavage of its substrates. In turn, the endoplasmic reticulum releases calcium in the cytoplasm and the nuclear activator of activated T-cells (NFAT translocates into the nucleus to perform its transcriptional duty. Plays a role in the positive regulation of IFNG transcription in T-helper 1 cells as part of an IFNG promoter-binding complex with PARP1 and EEF1A1. Within the complex, phosphorylates both PARP1 and EEF1A1. Phosphorylates also key sites in LCP2 leading to the up-regulation of Th1 preferred cytokine IL-2. Phosphorylates 'Tyr-201' of CTLA4 which leads to the association of PI-3 kinase with the CTLA4 receptor.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TXK Rabbit pAb (APR21342N) .

Synonyms

TXK; BTKL; PSCTK5; PTK4; RLK; TKL

Gene ID

7294

UniProt

P42681

Cellular Locus

Cell membrane, Cytoplasm, Nucleus, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 61kDa Observed MW: 85kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7294

Uniprot URL

https://www.uniprot.org/uniprot/P42681

AA Sequence

MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSNTGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWWKARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Cofilin 2 (muscle) Antibody
dAP-0693 50 µg

Goat anti-Cofilin 2 (muscle) Antibody

Sign In for Pricing
View Details
Mrgprx1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
30418116 3x 1.0 µg

Mrgprx1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Pig N-acetyl-β-D-glucosaminidase (NAG) ELISA Kit
CSB-E16198p-01 24 Well

Pig N-acetyl-β-D-glucosaminidase (NAG) ELISA Kit

Sign In for Pricing
View Details
Pig N-acetyl-β-D-glucosaminidase (NAG) ELISA Kit
CSB-E16198p-02 96 Well

Pig N-acetyl-β-D-glucosaminidase (NAG) ELISA Kit

Sign In for Pricing
View Details
Pig N-acetyl-β-D-glucosaminidase (NAG) ELISA Kit
CSB-E16198p-03 5x 96 Well

Pig N-acetyl-β-D-glucosaminidase (NAG) ELISA Kit

Sign In for Pricing
View Details
Pig N-acetyl-β-D-glucosaminidase (NAG) ELISA Kit
CSB-E16198p-04 10x 96 Well

Pig N-acetyl-β-D-glucosaminidase (NAG) ELISA Kit

Sign In for Pricing
View Details