Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A6 Rabbit pAb (APR21333N)

Product Specifications

Background

This gene encodes a multi-pass membrane protein that is a member of a family of sodium and chloride-ion dependent transporters. The encoded protein transports taurine and beta-alanine. There is a pseudogene for this gene on chromosome 21. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC6A6 Rabbit pAb (APR21333N) .

Synonyms

SLC6A6; TAUT

Gene ID

6533

UniProt

P31641

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/69kDa Observed MW: 70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6533

Uniprot URL

https://www.uniprot.org/uniprot/P31641

AA Sequence

LFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC300E+-MT-IN-1Y Training Services
323130 1 Pack (1 Piece (s) x 1 Piece)

MC300E+-MT-IN-1Y Training Services

Sign In for Pricing
View Details
PPP1R7 Antibody - middle region : HRP (ARP56407_P050-HRP)
ARP56407_P050-HRP 100 µL

PPP1R7 Antibody - middle region : HRP (ARP56407_P050-HRP)

Sign In for Pricing
View Details
Human JMJD6 Protein Lysate
MBS8413814-01 0.02 mg

Human JMJD6 Protein Lysate

Sign In for Pricing
View Details
Human JMJD6 Protein Lysate
MBS8413814-02 5x 0.02 mg

Human JMJD6 Protein Lysate

Sign In for Pricing
View Details
IGBP1, ID (IGBP1, IBP1, Immunoglobulin-binding protein 1, B-cell signal transduction molecule alpha 4, CD79a-binding protein 1, Renal carcinoma antigen NY-REN-16)
MBS641703-01 0.2 mL

IGBP1, ID (IGBP1, IBP1, Immunoglobulin-binding protein 1, B-cell signal transduction molecule alpha 4, CD79a-binding protein 1, Renal carcinoma antigen NY-REN-16)

Sign In for Pricing
View Details
IGBP1, ID (IGBP1, IBP1, Immunoglobulin-binding protein 1, B-cell signal transduction molecule alpha 4, CD79a-binding protein 1, Renal carcinoma antigen NY-REN-16)
MBS641703-02 5x 0.2 mL

IGBP1, ID (IGBP1, IBP1, Immunoglobulin-binding protein 1, B-cell signal transduction molecule alpha 4, CD79a-binding protein 1, Renal carcinoma antigen NY-REN-16)

Sign In for Pricing
View Details