Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A5 Rabbit pAb (APR21329N)

Product Specifications

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality S100A5 Rabbit pAb (APR21329N) .

Synonyms

S100A5; S100D

Gene ID

6276

UniProt

P33763

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/12kDa Observed MW: 11kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6276

Uniprot URL

https://www.uniprot.org/uniprot/P33763

AA Sequence

METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Myadm (NM_016969) Mouse Tagged ORF Clone Lentiviral Particle
MR218090L3V 200 µL

Myadm (NM_016969) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
CD23 (Blast 2, FC Epsilon RII, FC Receptor IgE Low Affinity II Alpha Polypeptide, FCER2A, IgE Binding Factor, IgE Receptor Lymphocyte, IGEBF, Low Affinity immunoglobulin, Ly42) Receptor Soluble Form, Ly42) (APC) discontinued
C2274-02J2-APC 100 µL

CD23 (Blast 2, FC Epsilon RII, FC Receptor IgE Low Affinity II Alpha Polypeptide, FCER2A, IgE Binding Factor, IgE Receptor Lymphocyte, IGEBF, Low Affinity immunoglobulin, Ly42) Receptor Soluble Form, Ly42) (APC) discontinued

Ask
View Details
Spata32 Mouse shRNA Plasmid (Locus ID 328019)
TL509993 1 Kit

Spata32 Mouse shRNA Plasmid (Locus ID 328019)

Ask
View Details
Propionylpromazine Hydrochloride
TRC-P827500-100MG 100 mg

Propionylpromazine Hydrochloride

Ask
View Details
Mouse Monoclonal CD74 Antibody (SPM523) [Alexa Fluor 405]
NBP2-34778AF405 0.1 mL

Mouse Monoclonal CD74 Antibody (SPM523) [Alexa Fluor 405]

Ask
View Details