Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Radixin Rabbit pAb (APR21327N)

Product Specifications

Background

Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated version representing a pseudogene (RDXP2) was assigned to Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was mapped to 11p by Southern and PCR analyses. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Radixin Rabbit pAb (APR21327N) .

Synonyms

RDX; DFNB24; radixin

Gene ID

5962

UniProt

P35241

Cellular Locus

Cell membrane, Cleavage furrow, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/29kDa/52kDa/68kDa/71kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5962

Uniprot URL

https://www.uniprot.org/uniprot/P35241

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ARSA (NM_000487) Human Over-expression Lysate
LH02935V 100 µg

ARSA (NM_000487) Human Over-expression Lysate

Ask
View Details
TRBV6-9 3'UTR Lenti-reporter-Luc Vector
47668081 1.0 µg

TRBV6-9 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
KCND2 (Potassium Voltage-Gated Channel Subfamily D Member 2, Voltage-Gated Potassium Channel Subunit Kv4.2, KIAA1044)
406613-01 50 µL

KCND2 (Potassium Voltage-Gated Channel Subfamily D Member 2, Voltage-Gated Potassium Channel Subunit Kv4.2, KIAA1044)

Ask
View Details
KCND2 (Potassium Voltage-Gated Channel Subfamily D Member 2, Voltage-Gated Potassium Channel Subunit Kv4.2, KIAA1044)
406613-02 100 µL

KCND2 (Potassium Voltage-Gated Channel Subfamily D Member 2, Voltage-Gated Potassium Channel Subunit Kv4.2, KIAA1044)

Ask
View Details
TBP, CT (TATA-box-binding Protein, TATA-box Factor, TATA-binding Factor, TATA Sequence-binding Protein, Transcription Initiation Factor TFIID TBP Subunit, TFIID, TF2D, GTF2D1) (HRP)
MBS6502023-01 0.2 mL

TBP, CT (TATA-box-binding Protein, TATA-box Factor, TATA-binding Factor, TATA Sequence-binding Protein, Transcription Initiation Factor TFIID TBP Subunit, TFIID, TF2D, GTF2D1) (HRP)

Ask
View Details
TBP, CT (TATA-box-binding Protein, TATA-box Factor, TATA-binding Factor, TATA Sequence-binding Protein, Transcription Initiation Factor TFIID TBP Subunit, TFIID, TF2D, GTF2D1) (HRP)
MBS6502023-02 5x 0.2 mL

TBP, CT (TATA-box-binding Protein, TATA-box Factor, TATA-binding Factor, TATA Sequence-binding Protein, Transcription Initiation Factor TFIID TBP Subunit, TFIID, TF2D, GTF2D1) (HRP)

Ask
View Details