Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] MEK2 Rabbit pAb (APR21320N)

Product Specifications

Background

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] MEK2 Rabbit pAb (APR21320N) .

Synonyms

CFC4; MAPKK2; MEK2; MKK2; PRKMK2; MAP2K2

Gene ID

5605

UniProt

P36507

Cellular Locus

Cytoplasm, Membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa Observed MW: 45KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5605

Uniprot URL

https://www.uniprot.org/uniprot/P36507

AA Sequence

MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
MBS2168409-01 0.1 mL

HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
MBS2168409-02 0.2 mL

HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
MBS2168409-03 0.5 mL

HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
MBS2168409-04 1 mL

HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
MBS2168409-05 5 mL

HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
MBS2168409-06 5x 5 mL

HRP-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)

Sign In for Pricing
View Details