Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1 Rabbit pAb (APR21304N)

Product Specifications

Background

This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Alternative splicing results in multiple transcript variants encoding different isoforms, at least one of which is proteolytically processed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NFKB1 Rabbit pAb (APR21304N) .

Synonyms

NFKB1; CVID12; EBP-1; KBF1; NF-kB1; NF-kappa-B; NF-kappaB; NFKB-p105; NFKB-p50; NFkappaB; p105; p50

Gene ID

4790

UniProt

P19838

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 85kDa/105kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4790

Uniprot URL

https://www.uniprot.org/uniprot/P19838

AA Sequence

DFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)
MBS1082964-01 0.02 mg (E-Coli)

Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)

Ask
View Details
Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)
MBS1082964-02 0.02 mg (Yeast)

Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)

Ask
View Details
Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)
MBS1082964-03 0.1 mg (E-Coli)

Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)

Ask
View Details
Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)
MBS1082964-04 0.1 mg (Yeast)

Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)

Ask
View Details
Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)
MBS1082964-05 0.02 mg (Baculovirus)

Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)

Ask
View Details
Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)
MBS1082964-06 0.02 mg (Mammalian-Cell)

Recombinant African swine fever virus Uncharacterized protein B354L (Mal-086)

Ask
View Details