Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD239/BCAM Rabbit pAb (APR21298N)

Product Specifications

Background

This gene encodes Lutheran blood group glycoprotein, a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five extracellular immunoglobulin domains, a single transmembrane domain, and a short C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Polymorphisms in this gene define some of the antigens in the Lutheran system and also the Auberger system. Inactivating variants of this gene result in the recessive Lutheran null phenotype, Lu (a-b-), of the Lutheran blood group. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD239/BCAM Rabbit pAb (APR21298N) .

Synonyms

BCAM; AU; CD239; LU; MSK19

Gene ID

4059

UniProt

P50895

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 67kDa Observed MW: 100kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4059

Uniprot URL

https://www.uniprot.org/uniprot/P50895

AA Sequence

KTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit
MBS7265833-01 48 Well

Sheep Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit

Ask
View Details
Sheep Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit
MBS7265833-02 96 Well

Sheep Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit

Ask
View Details
Sheep Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit
MBS7265833-03 5x 96 Well

Sheep Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit

Ask
View Details
Sheep Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit
MBS7265833-04 10x 96 Well

Sheep Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit

Ask
View Details
RPRD1A (Regulation of Nuclear pre-mRNA Domain Containing 1A, FLJ10656, HsT3101, MGC19513, P15RS)
251268 50 µg

RPRD1A (Regulation of Nuclear pre-mRNA Domain Containing 1A, FLJ10656, HsT3101, MGC19513, P15RS)

Ask
View Details
Human FLJ45513 knockout cell line
ABC-KH5595 1 Vial

Human FLJ45513 knockout cell line

Ask
View Details