Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC11 Rabbit pAb (APR21292N)

Product Specifications

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene binds to a promoter element of the lactase-phlorizin hydrolase. It also may play a role in early intestinal development. An alternatively spliced variant encoding a shorter isoform has been described but its full-length nature has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HOXC11 Rabbit pAb (APR21292N) .

Synonyms

HOXC11; HOX3H

Gene ID

3227

UniProt

O43248

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3227

Uniprot URL

https://www.uniprot.org/uniprot/O43248

AA Sequence

MFNSVNLGNFCSPSRKERGADFGERGSCASNLYLPSCTYYMPEFSTVSSFLPQAPSRQISYPYSAQVPPVREVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHATPAGFYSSVNKNSVLPQAFDRFFDNAYCGGGDPPAEPPCSGKGEAKGEPEAPPASGLASRAEAGAEAEAEEENTNPSSSGSAHSVAKEPAKGAAPNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DAZ2 activation kit by CRISPRa
GA111353 1 Kit

Human DAZ2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD33 Recombinant Rabbit monoclonal Antibody
HA750814 100 µL

CD33 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HypoGel® 200 REM
SP200110150180.5G 5 g

HypoGel® 200 REM

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS505709 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35 + MSA/953), CF640R conjugate, 0.1mg/mL
BNC401013-500 1x 500 µL

Muscle Specific Actin (HHF35 + MSA/953), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CEACAM7 (NM_006890) Human Recombinant Protein
TP312214 20 µg

CEACAM7 (NM_006890) Human Recombinant Protein

Sign In for Pricing
View Details