Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHB6 Rabbit pAb (APR21279N)

Product Specifications

Background

This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EPHB6 Rabbit pAb (APR21279N) .

Synonyms

EPHB6; HEP

Gene ID

2051

UniProt

O15197

Cellular Locus

Membrane, Secreted, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa/81kDa/110kDa Observed MW: 111kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2051

Uniprot URL

https://www.uniprot.org/uniprot/O15197

AA Sequence

HFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine B cell receptor associated protein 31 (BCAP31) ELISA kit
GTR10463785 96 Well

Bovine B cell receptor associated protein 31 (BCAP31) ELISA kit

Sign In for Pricing
View Details
ABCG1 discontinued
505542-01 50 µL

ABCG1 discontinued

Sign In for Pricing
View Details
ABCG1 discontinued
505542-02 100 µL

ABCG1 discontinued

Sign In for Pricing
View Details
G protein-coupled receptor 62 antibody
MBS9405395-01 0.1 mL

G protein-coupled receptor 62 antibody

Sign In for Pricing
View Details
G protein-coupled receptor 62 antibody
MBS9405395-02 5x 0.1 mL

G protein-coupled receptor 62 antibody

Sign In for Pricing
View Details
Olr1311 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
33830116 3x 1.0 µg

Olr1311 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details