Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX8 Rabbit pAb (APR21274N)

Product Specifications

Background

This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1) . Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DHX8 Rabbit pAb (APR21274N) .

Synonyms

DHX8; DDX8; HRH1; PRP22; PRPF22; Dhr2

Gene ID

1659

UniProt

Q14562

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 139kDa Observed MW: 139kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1659

Uniprot URL

https://www.uniprot.org/uniprot/Q14562

AA Sequence

CSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LENG8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1207908 1.0 µg DNA

LENG8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NGAL (25kD alpha-2-microglobulin-related Subunit of MMP-9, HNL, Lcn2, Lipocalin 2, Lipocalin-2, Migration Stimulating Factor Inhibitor, MSFI, Neutrophil Gelatinase-Associated Lipocalin, Oncogene 24p3, p25, Siderocalin)
381665 100 µL

NGAL (25kD alpha-2-microglobulin-related Subunit of MMP-9, HNL, Lcn2, Lipocalin 2, Lipocalin-2, Migration Stimulating Factor Inhibitor, MSFI, Neutrophil Gelatinase-Associated Lipocalin, Oncogene 24p3, p25, Siderocalin)

Sign In for Pricing
View Details
Anti-Vitamin D-binding protein / GC antibody
STJ71298 100 µg

Anti-Vitamin D-binding protein / GC antibody

Sign In for Pricing
View Details
RTN4R Protein Vector (Human) (pPM-C-HA)
PV036535 500 ng

RTN4R Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rat acidic isoferritin, AIF ELISA KIT
E0573Ra-01 48 Well

Rat acidic isoferritin, AIF ELISA KIT

Sign In for Pricing
View Details
Rat acidic isoferritin, AIF ELISA KIT
E0573Ra-02 96 Well

Rat acidic isoferritin, AIF ELISA KIT

Sign In for Pricing
View Details