Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX8 Rabbit pAb (APR21274N)

Product Specifications

Background

This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1) . Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DHX8 Rabbit pAb (APR21274N) .

Synonyms

DHX8; DDX8; HRH1; PRP22; PRPF22; Dhr2

Gene ID

1659

UniProt

Q14562

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 139kDa Observed MW: 139kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1659

Uniprot URL

https://www.uniprot.org/uniprot/Q14562

AA Sequence

CSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BDH2 Antibody (OTI2G1) [DyLight 650]
NBP2-72067C 0.1 mL

Mouse Monoclonal BDH2 Antibody (OTI2G1) [DyLight 650]

Sign In for Pricing
View Details
Rabbit Polyclonal TBX5 Antibody [DyLight 755]
NBP2-99529IR 0.1 mL

Rabbit Polyclonal TBX5 Antibody [DyLight 755]

Sign In for Pricing
View Details
Human TPBGL Pre-designed siRNA Set A
SI017198A 1 Each

Human TPBGL Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human IRF9 Protein - (Dry Ice)
H00010379-P01-25ug 25 µg

Recombinant Human IRF9 Protein - (Dry Ice)

Sign In for Pricing
View Details
TRIM21 (386-398) goat polyclonal antibody, Aff - Purified
AP08885PU-N 50 µg

TRIM21 (386-398) goat polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
LHX4 (LIM/Homeobox Protein Lhx4, LIM Homeobox Protein 4) (MaxLight 550)
129082-ML550 100 µL

LHX4 (LIM/Homeobox Protein Lhx4, LIM Homeobox Protein 4) (MaxLight 550)

Sign In for Pricing
View Details