Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAD1 Rabbit pAb (APR21273N)

Product Specifications

Background

DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DAD1 Rabbit pAb (APR21273N) .

Synonyms

DAD1; OST2

Gene ID

1603

UniProt

P61803

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 22kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1603

Uniprot URL

https://www.uniprot.org/uniprot/P61803

AA Sequence

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LBP Protein (His Tag)
PKSH033414-01 10 µg

Recombinant Human LBP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LBP Protein (His Tag)
PKSH033414-02 50 µg

Recombinant Human LBP Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS623222 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800322 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Knl1 Mouse Gene Knockout Kit (CRISPR)
KN502557 1 Kit

Knl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF594 conjugate, 0.1mg/mL
BNC941969-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details