Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA5A Rabbit pAb (APR21258N)

Product Specifications

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CA5A Rabbit pAb (APR21258N) .

Synonyms

CA5A; CA5; CA5AD; CAV; CAVA; GS1-21A4.1

Gene ID

763

UniProt

P35218

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=763

Uniprot URL

https://www.uniprot.org/uniprot/P35218

AA Sequence

CAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS622096 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF740 conjugate, 0.1mg/mL
BNC740984-500 1x 500 µL

P21 / WAF1 (HJ21), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ReadiUse™ mammalian cell lysis buffer *5X*
20012-AAT 10 mL

ReadiUse™ mammalian cell lysis buffer *5X*

Sign In for Pricing
View Details
B2M Polyclonal Antibody
D-AB-10197L-01 25 µL

B2M Polyclonal Antibody

Sign In for Pricing
View Details
B2M Polyclonal Antibody
D-AB-10197L-02 100 µL

B2M Polyclonal Antibody

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), 0.2mg/mL
BNUB2151-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), 0.2mg/mL

Sign In for Pricing
View Details