Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alcohol Dehydrogenase Rabbit pAb (APR21250N)

Product Specifications

Background

This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze the oxidation of alcohols to aldehydes. This gene is active in the liver in early fetal life but only weakly active in adult liver. This gene is found in a cluster with six additional alcohol dehydrogenase genes, including those encoding the beta and gamma subunits, on the long arm of chromosome 4. Mutations in this gene may contribute to variation in certain personality traits and substance dependence.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Alcohol Dehydrogenase Rabbit pAb (APR21250N) .

Synonyms

ADH1A; ADH1

Gene ID

124

UniProt

P07327

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=124

Uniprot URL

https://www.uniprot.org/uniprot/P07327

AA Sequence

IIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40L Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-63025R-BF405 100 µL

CD40L Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
NR2C1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1452105 3x 1.0 µg

NR2C1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rat Septin-11, SEPT11 ELISA Kit
MBS9319973-01 48 Well

Rat Septin-11, SEPT11 ELISA Kit

Sign In for Pricing
View Details
Rat Septin-11, SEPT11 ELISA Kit
MBS9319973-02 96 Well

Rat Septin-11, SEPT11 ELISA Kit

Sign In for Pricing
View Details
Rat Septin-11, SEPT11 ELISA Kit
MBS9319973-03 5x 96 Well

Rat Septin-11, SEPT11 ELISA Kit

Sign In for Pricing
View Details
Rat Septin-11, SEPT11 ELISA Kit
MBS9319973-04 10x 96 Well

Rat Septin-11, SEPT11 ELISA Kit

Sign In for Pricing
View Details