Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD209 Rabbit pAb (APR21215N)

Product Specifications

Background

This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN) . DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD209 Rabbit pAb (APR21215N) .

Synonyms

CD209; CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1

Gene ID

30835

UniProt

Q9NNX6

Cellular Locus

Cell membrane, Secreted, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 4kDa/18kDa/30-45kDa Observed MW: 55KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=30835

Uniprot URL

https://www.uniprot.org/uniprot/Q9NNX6

AA Sequence

GNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN2 Rabbit Polyclonal Antibody (Carrier-free)
orb3106871 100 µg

NSUN2 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
ANKS6 Antibody - middle region
OAAB10271-400UL 400 µL

ANKS6 Antibody - middle region

Sign In for Pricing
View Details
USP9X Recombinant Antibody, PE-Cy5 Conjugated
bsm-61894R-PE-Cy5-TR 20 µL

USP9X Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
GMPSP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV762291 1.0 µg DNA

GMPSP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Tunicamycin, ER stress inducer
TBI2111-25MG 25 mg

Tunicamycin, ER stress inducer

Sign In for Pricing
View Details
Mouse Monoclonal JAM-B/VE-JAM Antibody (988934) [CoraFluor 1]
FAB10743CL1 0.1 mL

Mouse Monoclonal JAM-B/VE-JAM Antibody (988934) [CoraFluor 1]

Sign In for Pricing
View Details